PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00845g00116.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family G2-like
Protein Properties Length: 489aa    MW: 53503.5 Da    PI: 6.6471
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00845g00116.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like87.11.7e-27202255256
                   G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                                +++WtpeLH+rFv+aveqL G +kA+P++ile+m++++Lt+++++SHLQkYR++
  Peaxi162Scf00845g00116.1 202 IKVDWTPELHRRFVQAVEQL-GVDKAVPSRILEIMGIDCLTRHNIASHLQKYRSH 255
                               5899****************.********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.737198257IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.3E-26199258IPR009057Homeodomain-like
SuperFamilySSF466896.99E-18200258IPR009057Homeodomain-like
TIGRFAMsTIGR015573.4E-26201255IPR006447Myb domain, plants
PfamPF002491.6E-7204253IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 489 aa     Download sequence    Send to blast
YIVSFIVFQF LHATLNSPAT VHIITCLVHC VFVMLAVSPL SNTTSKDHER NNEMESFTIG  60
GSDDFPDFVG ENLLDSIDFD DLFVGINDGD VLPDLEMDTE ILAEFSVSSG EESDVNNYNS  120
TTSSTPTLQS LELQENCNTS GSASDLGSGL TSLNNQGEEI VSIRKNEEYA PPVYHNHTPK  180
ENDKPKKSSS QSKNNPPGKR KIKVDWTPEL HRRFVQAVEQ LGVDKAVPSR ILEIMGIDCL  240
TRHNIASHLQ KYRSHRKHLL AREAEAASWS QRRQIYGGAA ATGGGGKRDM NPWPAPTIGF  300
PPPPMATPPM PHFRPLHVWG HPSVDQSYMH MWPKHLAPSP SPPPAWAQAP PPHLHPSQHV  360
DPSFWHPHHQ RVPNSLTPGT PYFPAPIAPT NNFVQRFPAP HPVPGIPPPA MYKVDPGIGV  420
RTAPAGAGQP LPKPPCDFHP SKESIDAAIG DVLSKPWLPL PLGLKPPAVD SVLGELQRQG  480
VPKIPPTCA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A6e-16198253257ARR10-B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJF8079441e-161JF807944.1 Capsicum annuum golden 2-like 1 transcription factor (GLK1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009601765.10.0PREDICTED: transcription activator GLK1-like
RefseqXP_016499361.10.0PREDICTED: transcription activator GLK1-like
SwissprotQ9SIV34e-97GLK1_ARATH; Transcription activator GLK1
TrEMBLM1AJS10.0M1AJS1_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000242650.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA25322356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G20570.12e-66GBF's pro-rich region-interacting factor 1